COX6C monoclonal antibody (M03), clone S51
  • COX6C monoclonal antibody (M03), clone S51

COX6C monoclonal antibody (M03), clone S51

Ref: AB-H00001345-M03
COX6C monoclonal antibody (M03), clone S51

Información del producto

Mouse monoclonal antibody raised against a full length recombinant COX6C.
Información adicional
Size 100 ug
Gene Name COX6C
Gene Alias -
Gene Description cytochrome c oxidase subunit VIc
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1345
Clone Number S51
Iso type IgG1 Kappa

Enviar un mensaje


COX6C monoclonal antibody (M03), clone S51

COX6C monoclonal antibody (M03), clone S51