COX5B monoclonal antibody (M03), clone 1E8
  • COX5B monoclonal antibody (M03), clone 1E8

COX5B monoclonal antibody (M03), clone 1E8

Ref: AB-H00001329-M03
COX5B monoclonal antibody (M03), clone 1E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COX5B.
Información adicional
Size 100 ug
Gene Name COX5B
Gene Alias COXVB
Gene Description cytochrome c oxidase subunit Vb
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COX5B (NP_001853, 37 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1329
Clone Number 1E8
Iso type IgG1 Kappa

Enviar un mensaje


COX5B monoclonal antibody (M03), clone 1E8

COX5B monoclonal antibody (M03), clone 1E8