COX5B purified MaxPab mouse polyclonal antibody (B01P)
  • COX5B purified MaxPab mouse polyclonal antibody (B01P)

COX5B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001329-B01P
COX5B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human COX5B protein.
Información adicional
Size 50 ug
Gene Name COX5B
Gene Alias COXVB
Gene Description cytochrome c oxidase subunit Vb
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COX5B (NP_001853.2, 1 a.a. ~ 129 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1329

Enviar un mensaje


COX5B purified MaxPab mouse polyclonal antibody (B01P)

COX5B purified MaxPab mouse polyclonal antibody (B01P)