COX4I1 purified MaxPab rabbit polyclonal antibody (D01P) Ver mas grande

COX4I1 purified MaxPab rabbit polyclonal antibody (D01P)

AB-H00001327-D01P

Producto nuevo

COX4I1 purified MaxPab rabbit polyclonal antibody (D01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name COX4I1
Gene Alias COX4|COXIV|MGC72016
Gene Description cytochrome c oxidase subunit IV isoform 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COX4I1 (NP_001852.1, 1 a.a. ~ 169 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1327

Más información

Rabbit polyclonal antibody raised against a full-length human COX4I1 protein.

Consulta sobre un producto

COX4I1 purified MaxPab rabbit polyclonal antibody (D01P)

COX4I1 purified MaxPab rabbit polyclonal antibody (D01P)