KLF6 polyclonal antibody (A01)
  • KLF6 polyclonal antibody (A01)

KLF6 polyclonal antibody (A01)

Ref: AB-H00001316-A01
KLF6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLF6.
Información adicional
Size 50 uL
Gene Name KLF6
Gene Alias BCD1|COPEB|CPBP|DKFZp686N0199|GBF|PAC1|ST12|ZF9
Gene Description Kruppel-like factor 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF6 (NP_001291, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1316

Enviar un mensaje


KLF6 polyclonal antibody (A01)

KLF6 polyclonal antibody (A01)