COPB monoclonal antibody (M08), clone 3E10
  • COPB monoclonal antibody (M08), clone 3E10

COPB monoclonal antibody (M08), clone 3E10

Ref: AB-H00001315-M08
COPB monoclonal antibody (M08), clone 3E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COPB.
Información adicional
Size 100 ug
Gene Name COPB1
Gene Alias COPB|DKFZp761K102|FLJ10341
Gene Description coatomer protein complex, subunit beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COPB (NP_057535, 854 a.a. ~ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1315
Clone Number 3E10
Iso type IgG2b Kappa

Enviar un mensaje


COPB monoclonal antibody (M08), clone 3E10

COPB monoclonal antibody (M08), clone 3E10