COMT MaxPab rabbit polyclonal antibody (D01)
  • COMT MaxPab rabbit polyclonal antibody (D01)

COMT MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001312-D01
COMT MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human COMT protein.
Información adicional
Size 100 uL
Gene Name COMT
Gene Alias -
Gene Description catechol-O-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COMT (NP_009294.1, 1 a.a. ~ 221 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1312

Enviar un mensaje


COMT MaxPab rabbit polyclonal antibody (D01)

COMT MaxPab rabbit polyclonal antibody (D01)