COMP purified MaxPab mouse polyclonal antibody (B01P)
  • COMP purified MaxPab mouse polyclonal antibody (B01P)

COMP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001311-B01P
COMP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human COMP protein.
Información adicional
Size 50 ug
Gene Name COMP
Gene Alias EDM1|EPD1|MED|MGC131819|MGC149768|PSACH|THBS5
Gene Description cartilage oligomeric matrix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COMP (ABM87644.1, 1 a.a. ~ 724 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1311

Enviar un mensaje


COMP purified MaxPab mouse polyclonal antibody (B01P)

COMP purified MaxPab mouse polyclonal antibody (B01P)