COL16A1 polyclonal antibody (A01)
  • COL16A1 polyclonal antibody (A01)

COL16A1 polyclonal antibody (A01)

Ref: AB-H00001307-A01
COL16A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COL16A1.
Información adicional
Size 50 uL
Gene Name COL16A1
Gene Alias 447AA|FP1572
Gene Description collagen, type XVI, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WYLFQVTDANGYPQISLEVNSQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVASVHVDCSSASSQPLGPRRPMRPVGHVFLGLDAEQGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL16A1 (NP_001847, 117 a.a. ~ 216 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1307

Enviar un mensaje


COL16A1 polyclonal antibody (A01)

COL16A1 polyclonal antibody (A01)