COL6A2 monoclonal antibody (M01), clone 2C5-F2
  • COL6A2 monoclonal antibody (M01), clone 2C5-F2

COL6A2 monoclonal antibody (M01), clone 2C5-F2

Ref: AB-H00001292-M01
COL6A2 monoclonal antibody (M01), clone 2C5-F2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant COL6A2.
Información adicional
Size 100 ug
Gene Name COL6A2
Gene Alias DKFZp586E1322|FLJ46862|PP3610
Gene Description collagen, type VI, alpha 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MTYVRETCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFVINVVNRLGAIAKDPKSETGTRVGVVQYSHEGTFEAIQLDDEHIDSLSSFKEAVKNLEWIAGGTWTPSALKFAYDRLIKESRRQKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHEKHESENLYSIACDKPQQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPDLPCQTELSVAQCTQRPVDIVFLLDGSERLGEQNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL6A2 (AAH02484, 1 a.a. ~ 425 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1292
Clone Number 2C5-F2
Iso type IgG2a kappa

Enviar un mensaje


COL6A2 monoclonal antibody (M01), clone 2C5-F2

COL6A2 monoclonal antibody (M01), clone 2C5-F2