COL6A2 polyclonal antibody (A01)
  • COL6A2 polyclonal antibody (A01)

COL6A2 polyclonal antibody (A01)

Ref: AB-H00001292-A01
COL6A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant COL6A2.
Información adicional
Size 50 uL
Gene Name COL6A2
Gene Alias DKFZp586E1322|FLJ46862|PP3610
Gene Description collagen, type VI, alpha 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTYVRETCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFVINVVNRLGAIAKDPKSETGTRVGVVQYSHEGTFEAIQLDDEHIDSLSSFKEAVKNLEWIAGGTWTPSALKFAYDRLIKESRRQKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHEKHESENLYSIACDKPQQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPDLPCQTELSVAQCTQRPVDIVFLLDGSERLGEQNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL6A2 (AAH02484, 1 a.a. ~ 425 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1292

Enviar un mensaje


COL6A2 polyclonal antibody (A01)

COL6A2 polyclonal antibody (A01)