COL3A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • COL3A1 purified MaxPab rabbit polyclonal antibody (D01P)

COL3A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001281-D01P
COL3A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human COL3A1 protein.
Información adicional
Size 100 ug
Gene Name COL3A1
Gene Alias EDS4A|FLJ34534
Gene Description collagen, type III, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMSFVQKGSWLLLALLHPTIILAQQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COL3A1 (AAH28178.1, 1 a.a. ~ 1163 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1281

Enviar un mensaje


COL3A1 purified MaxPab rabbit polyclonal antibody (D01P)

COL3A1 purified MaxPab rabbit polyclonal antibody (D01P)