COL1A2 monoclonal antibody (M03), clone 7E11
  • COL1A2 monoclonal antibody (M03), clone 7E11

COL1A2 monoclonal antibody (M03), clone 7E11

Ref: AB-H00001278-M03
COL1A2 monoclonal antibody (M03), clone 7E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COL1A2.
Información adicional
Size 100 ug
Gene Name COL1A2
Gene Alias OI4
Gene Description collagen, type I, alpha 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL1A2 (AAH54498.1, 1257 a.a. ~ 1366 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1278
Clone Number 7E11
Iso type IgG2a Kappa

Enviar un mensaje


COL1A2 monoclonal antibody (M03), clone 7E11

COL1A2 monoclonal antibody (M03), clone 7E11