CNTFR polyclonal antibody (A01)
  • CNTFR polyclonal antibody (A01)

CNTFR polyclonal antibody (A01)

Ref: AB-H00001271-A01
CNTFR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CNTFR.
Información adicional
Size 50 uL
Gene Name CNTFR
Gene Alias MGC1774
Gene Description ciliary neurotrophic factor receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNTFR (NP_671693, 47 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1271

Enviar un mensaje


CNTFR polyclonal antibody (A01)

CNTFR polyclonal antibody (A01)