CNTF purified MaxPab rabbit polyclonal antibody (D01P)
  • CNTF purified MaxPab rabbit polyclonal antibody (D01P)

CNTF purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001270-D01P
CNTF purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CNTF protein.
Información adicional
Size 100 ug
Gene Name CNTF
Gene Alias HCNTF
Gene Description ciliary neurotrophic factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CNTF (NP_000605.1, 1 a.a. ~ 200 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1270

Enviar un mensaje


CNTF purified MaxPab rabbit polyclonal antibody (D01P)

CNTF purified MaxPab rabbit polyclonal antibody (D01P)