CNTF MaxPab rabbit polyclonal antibody (D01)
  • CNTF MaxPab rabbit polyclonal antibody (D01)

CNTF MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001270-D01
CNTF MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CNTF protein.
Información adicional
Size 100 uL
Gene Name CNTF
Gene Alias HCNTF
Gene Description ciliary neurotrophic factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CNTF (NP_000605.1, 1 a.a. ~ 200 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1270

Enviar un mensaje


CNTF MaxPab rabbit polyclonal antibody (D01)

CNTF MaxPab rabbit polyclonal antibody (D01)