CNN3 monoclonal antibody (M01), clone 4C4
  • CNN3 monoclonal antibody (M01), clone 4C4

CNN3 monoclonal antibody (M01), clone 4C4

Ref: AB-H00001266-M01
CNN3 monoclonal antibody (M01), clone 4C4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CNN3.
Información adicional
Size 100 ug
Gene Name CNN3
Gene Alias -
Gene Description calponin 3, acidic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNN3 (NP_001830.1, 1 a.a. ~ 329 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1266
Clone Number 4C4
Iso type IgG2a Kappa

Enviar un mensaje


CNN3 monoclonal antibody (M01), clone 4C4

CNN3 monoclonal antibody (M01), clone 4C4