CLTC polyclonal antibody (A01)
  • CLTC polyclonal antibody (A01)

CLTC polyclonal antibody (A01)

Ref: AB-H00001213-A01
CLTC polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLTC.
Información adicional
Size 50 uL
Gene Name CLTC
Gene Alias CHC|CHC17|CLH-17|CLTCL2|Hc|KIAA0034
Gene Description clathrin, heavy chain (Hc)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLTC (NP_004850, 232 a.a. ~ 340 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1213

Enviar un mensaje


CLTC polyclonal antibody (A01)

CLTC polyclonal antibody (A01)