CLTA monoclonal antibody (M12), clone 4D5
  • CLTA monoclonal antibody (M12), clone 4D5

CLTA monoclonal antibody (M12), clone 4D5

Ref: AB-H00001211-M12
CLTA monoclonal antibody (M12), clone 4D5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CLTA.
Información adicional
Size 100 ug
Gene Name CLTA
Gene Alias LCA
Gene Description clathrin, light chain (Lca)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLTA (AAH19287, 1 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1211
Clone Number 4D5
Iso type IgG2a Kappa

Enviar un mensaje


CLTA monoclonal antibody (M12), clone 4D5

CLTA monoclonal antibody (M12), clone 4D5