CLPTM1 polyclonal antibody (A01)
  • CLPTM1 polyclonal antibody (A01)

CLPTM1 polyclonal antibody (A01)

Ref: AB-H00001209-A01
CLPTM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLPTM1.
Información adicional
Size 50 uL
Gene Name CLPTM1
Gene Alias -
Gene Description cleft lip and palate associated transmembrane protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLPTM1 (NP_001285, 151 a.a. ~ 251 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1209

Enviar un mensaje


CLPTM1 polyclonal antibody (A01)

CLPTM1 polyclonal antibody (A01)