TPP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TPP1 purified MaxPab rabbit polyclonal antibody (D01P)

TPP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001200-D01P
TPP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TPP1 protein.
Información adicional
Size 100 ug
Gene Name TPP1
Gene Alias CLN2|GIG1|LPIC|MGC21297
Gene Description tripeptidyl peptidase I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MGLQACLLGLFALILSGKCSYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVERLSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFLTCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTSSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPP1 (NP_000382.3, 1 a.a. ~ 563 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1200

Enviar un mensaje


TPP1 purified MaxPab rabbit polyclonal antibody (D01P)

TPP1 purified MaxPab rabbit polyclonal antibody (D01P)