CLU monoclonal antibody (M01), clone 1A11
  • CLU monoclonal antibody (M01), clone 1A11

CLU monoclonal antibody (M01), clone 1A11

Ref: AB-H00001191-M01
CLU monoclonal antibody (M01), clone 1A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLU.
Información adicional
Size 100 ug
Gene Name CLU
Gene Alias AAG4|APOJ|CLI|KUB1|MGC24903|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
Gene Description clusterin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLU (NP_001822, 402 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1191
Clone Number 1A11
Iso type IgG1 Kappa

Enviar un mensaje


CLU monoclonal antibody (M01), clone 1A11

CLU monoclonal antibody (M01), clone 1A11