CLCN7 monoclonal antibody (M01A), clone 4A3
  • CLCN7 monoclonal antibody (M01A), clone 4A3

CLCN7 monoclonal antibody (M01A), clone 4A3

Ref: AB-H00001186-M01A
CLCN7 monoclonal antibody (M01A), clone 4A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLCN7.
Información adicional
Size 200 uL
Gene Name CLCN7
Gene Alias CLC-7|CLC7|FLJ26686|FLJ39644|FLJ46423|OPTA2|OPTB4
Gene Description chloride channel 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLCN7 (NP_001278, 706 a.a. ~ 805 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 1186
Clone Number 4A3
Iso type IgG2a Kappa

Enviar un mensaje


CLCN7 monoclonal antibody (M01A), clone 4A3

CLCN7 monoclonal antibody (M01A), clone 4A3