CLCN6 monoclonal antibody (M05), clone 2H2
  • CLCN6 monoclonal antibody (M05), clone 2H2

CLCN6 monoclonal antibody (M05), clone 2H2

Ref: AB-H00001185-M05
CLCN6 monoclonal antibody (M05), clone 2H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLCN6.
Información adicional
Size 100 ug
Gene Name CLCN6
Gene Alias CLC-6|KIAA0046
Gene Description chloride channel 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEIVGIITRHNLTYEFLQARLRQHYQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLCN6 (NP_001277.1, 770 a.a. ~ 868 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1185
Clone Number 2H2
Iso type IgG2b Kappa

Enviar un mensaje


CLCN6 monoclonal antibody (M05), clone 2H2

CLCN6 monoclonal antibody (M05), clone 2H2