AP1S1 purified MaxPab mouse polyclonal antibody (B02P)
  • AP1S1 purified MaxPab mouse polyclonal antibody (B02P)

AP1S1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00001174-B02P
AP1S1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AP1S1 protein.
Información adicional
Size 50 ug
Gene Name AP1S1
Gene Alias AP19|CLAPS1|FLJ92436|SIGMA1A|WUGSC:H_DJ0747G18.2
Gene Description adaptor-related protein complex 1, sigma 1 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AP1S1 (NP_001274.1, 1 a.a. ~ 158 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1174

Enviar un mensaje


AP1S1 purified MaxPab mouse polyclonal antibody (B02P)

AP1S1 purified MaxPab mouse polyclonal antibody (B02P)