CKS2 monoclonal antibody (M01), clone 2H5-2C4
  • CKS2 monoclonal antibody (M01), clone 2H5-2C4

CKS2 monoclonal antibody (M01), clone 2H5-2C4

Ref: AB-H00001164-M01
CKS2 monoclonal antibody (M01), clone 2H5-2C4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CKS2.
Información adicional
Size 100 ug
Gene Name CKS2
Gene Alias CKSHS2
Gene Description CDC28 protein kinase regulatory subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CKS2 (AAH06458, 1 a.a. ~ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1164
Clone Number 2H5-2C4
Iso type IgG2b kappa

Enviar un mensaje


CKS2 monoclonal antibody (M01), clone 2H5-2C4

CKS2 monoclonal antibody (M01), clone 2H5-2C4