TBCB polyclonal antibody (A01)
  • TBCB polyclonal antibody (A01)

TBCB polyclonal antibody (A01)

Ref: AB-H00001155-A01
TBCB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TBCB.
Información adicional
Size 50 uL
Gene Name TBCB
Gene Alias CG22|CKAP1|CKAPI|MGC14625
Gene Description tubulin folding cofactor B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TBCB (NP_001272, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1155

Enviar un mensaje


TBCB polyclonal antibody (A01)

TBCB polyclonal antibody (A01)