CIRBP monoclonal antibody (M03), clone 1C9
  • CIRBP monoclonal antibody (M03), clone 1C9

CIRBP monoclonal antibody (M03), clone 1C9

Ref: AB-H00001153-M03
CIRBP monoclonal antibody (M03), clone 1C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CIRBP.
Información adicional
Size 100 ug
Gene Name CIRBP
Gene Alias CIRP
Gene Description cold inducible RNA binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIRBP (NP_001271.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1153
Clone Number 1C9
Iso type IgG2a Kappa

Enviar un mensaje


CIRBP monoclonal antibody (M03), clone 1C9

CIRBP monoclonal antibody (M03), clone 1C9