CIRBP purified MaxPab rabbit polyclonal antibody (D01P)
  • CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001153-D01P
CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CIRBP protein.
Información adicional
Size 100 ug
Gene Name CIRBP
Gene Alias CIRP
Gene Description cold inducible RNA binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CIRBP (NP_001271.1, 1 a.a. ~ 172 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1153

Enviar un mensaje


CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

CIRBP purified MaxPab rabbit polyclonal antibody (D01P)