CIDEA purified MaxPab rabbit polyclonal antibody (D01P)
  • CIDEA purified MaxPab rabbit polyclonal antibody (D01P)

CIDEA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001149-D01P
CIDEA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CIDEA protein.
Información adicional
Size 100 ug
Gene Name CIDEA
Gene Alias CIDE-A
Gene Description cell death-inducing DFFA-like effector a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CIDEA (NP_938031.1, 1 a.a. ~ 253 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1149

Enviar un mensaje


CIDEA purified MaxPab rabbit polyclonal antibody (D01P)

CIDEA purified MaxPab rabbit polyclonal antibody (D01P)