CHRNA2 polyclonal antibody (A01)
  • CHRNA2 polyclonal antibody (A01)

CHRNA2 polyclonal antibody (A01)

Ref: AB-H00001135-A01
CHRNA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHRNA2.
Información adicional
Size 50 uL
Gene Name CHRNA2
Gene Alias -
Gene Description cholinergic receptor, nicotinic, alpha 2 (neuronal)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EEAKRPPPRAPGDPLSSPSPTALPQGGSHTETEDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPADFGNITSLRVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHRNA2 (NP_000733, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1135

Enviar un mensaje


CHRNA2 polyclonal antibody (A01)

CHRNA2 polyclonal antibody (A01)