CHML monoclonal antibody (M03), clone 5G4
  • CHML monoclonal antibody (M03), clone 5G4

CHML monoclonal antibody (M03), clone 5G4

Ref: AB-H00001122-M03
CHML monoclonal antibody (M03), clone 5G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHML.
Información adicional
Size 100 ug
Gene Name CHML
Gene Alias FLJ10071|FLJ13361|REP2
Gene Description choroideremia-like (Rab escort protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHML (NP_001812, 68 a.a. ~ 177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1122
Clone Number 5G4
Iso type IgG2a Kappa

Enviar un mensaje


CHML monoclonal antibody (M03), clone 5G4

CHML monoclonal antibody (M03), clone 5G4