CHML purified MaxPab rabbit polyclonal antibody (D01P)
  • CHML purified MaxPab rabbit polyclonal antibody (D01P)

CHML purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001122-D01P
CHML purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CHML protein.
Información adicional
Size 100 ug
Gene Name CHML
Gene Alias FLJ10071|FLJ13361|REP2
Gene Description choroideremia-like (Rab escort protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MADNLPTEFDVVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASFSFSGLLSWLKEYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVSKLLYSQGLLIDLLIKSDVSR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHML (NP_001812.2, 1 a.a. ~ 656 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1122

Enviar un mensaje


CHML purified MaxPab rabbit polyclonal antibody (D01P)

CHML purified MaxPab rabbit polyclonal antibody (D01P)