CHML polyclonal antibody (A01)
  • CHML polyclonal antibody (A01)

CHML polyclonal antibody (A01)

Ref: AB-H00001122-A01
CHML polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHML.
Información adicional
Size 50 uL
Gene Name CHML
Gene Alias FLJ10071|FLJ13361|REP2
Gene Description choroideremia-like (Rab escort protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHML (NP_001812, 68 a.a. ~ 177 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1122

Enviar un mensaje


CHML polyclonal antibody (A01)

CHML polyclonal antibody (A01)