CHIT1 purified MaxPab mouse polyclonal antibody (B01P)
  • CHIT1 purified MaxPab mouse polyclonal antibody (B01P)

CHIT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001118-B01P
CHIT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CHIT1 protein.
Información adicional
Size 50 ug
Gene Name CHIT1
Gene Alias CHI3|CHIT|FLJ00314|MGC125322
Gene Description chitinase 1 (chitotriosidase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFSTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHIT1 (AAI03696.1, 1 a.a. ~ 466 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1118

Enviar un mensaje


CHIT1 purified MaxPab mouse polyclonal antibody (B01P)

CHIT1 purified MaxPab mouse polyclonal antibody (B01P)