CHD4 monoclonal antibody (M01), clone 4H4
  • CHD4 monoclonal antibody (M01), clone 4H4

CHD4 monoclonal antibody (M01), clone 4H4

Ref: AB-H00001108-M01
CHD4 monoclonal antibody (M01), clone 4H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHD4.
Información adicional
Size 100 ug
Gene Name CHD4
Gene Alias DKFZp686E06161|Mi-2b|Mi2-BETA
Gene Description chromodomain helicase DNA binding protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHD4 (NP_001264, 1632 a.a. ~ 1730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1108
Clone Number 4H4
Iso type IgG2a Kappa

Enviar un mensaje


CHD4 monoclonal antibody (M01), clone 4H4

CHD4 monoclonal antibody (M01), clone 4H4