CHD4 polyclonal antibody (A01)
  • CHD4 polyclonal antibody (A01)

CHD4 polyclonal antibody (A01)

Ref: AB-H00001108-A01
CHD4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHD4.
Información adicional
Size 50 uL
Gene Name CHD4
Gene Alias DKFZp686E06161|Mi-2b|Mi2-BETA
Gene Description chromodomain helicase DNA binding protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHD4 (NP_001264, 1632 a.a. ~ 1730 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1108

Enviar un mensaje


CHD4 polyclonal antibody (A01)

CHD4 polyclonal antibody (A01)