RCC1 monoclonal antibody (M02), clone 1C1
  • RCC1 monoclonal antibody (M02), clone 1C1

RCC1 monoclonal antibody (M02), clone 1C1

Ref: AB-H00001104-M02
RCC1 monoclonal antibody (M02), clone 1C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RCC1.
Información adicional
Size 100 ug
Gene Name RCC1
Gene Alias CHC1|RCC1-I
Gene Description regulator of chromosome condensation 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCC1 (AAH07300, 312 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1104
Clone Number 1C1
Iso type IgG1 Kappa

Enviar un mensaje


RCC1 monoclonal antibody (M02), clone 1C1

RCC1 monoclonal antibody (M02), clone 1C1