RCC1 MaxPab rabbit polyclonal antibody (D01)
  • RCC1 MaxPab rabbit polyclonal antibody (D01)

RCC1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001104-D01
RCC1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RCC1 protein.
Información adicional
Size 100 uL
Gene Name RCC1
Gene Alias CHC1|RCC1-I
Gene Description regulator of chromosome condensation 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RCC1 (NP_001260.1, 1 a.a. ~ 421 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1104

Enviar un mensaje


RCC1 MaxPab rabbit polyclonal antibody (D01)

RCC1 MaxPab rabbit polyclonal antibody (D01)