RCC1 purified MaxPab mouse polyclonal antibody (B01P)
  • RCC1 purified MaxPab mouse polyclonal antibody (B01P)

RCC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001104-B01P
RCC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RCC1 protein.
Información adicional
Size 50 ug
Gene Name RCC1
Gene Alias CHC1|RCC1-I
Gene Description regulator of chromosome condensation 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RCC1 (NP_001260.1, 1 a.a. ~ 421 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1104

Enviar un mensaje


RCC1 purified MaxPab mouse polyclonal antibody (B01P)

RCC1 purified MaxPab mouse polyclonal antibody (B01P)