CHAT monoclonal antibody (M01), clone 1H7
  • CHAT monoclonal antibody (M01), clone 1H7

CHAT monoclonal antibody (M01), clone 1H7

Ref: AB-H00001103-M01
CHAT monoclonal antibody (M01), clone 1H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHAT.
Información adicional
Size 100 ug
Gene Name CHAT
Gene Alias CMS1A|CMS1A2
Gene Description choline acetyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHAT (NP_065574, 649 a.a. ~ 748 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1103
Clone Number 1H7
Iso type IgG1 Kappa

Enviar un mensaje


CHAT monoclonal antibody (M01), clone 1H7

CHAT monoclonal antibody (M01), clone 1H7