RCBTB2 purified MaxPab mouse polyclonal antibody (B01P)
  • RCBTB2 purified MaxPab mouse polyclonal antibody (B01P)

RCBTB2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001102-B01P
RCBTB2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RCBTB2 protein.
Información adicional
Size 50 ug
Gene Name RCBTB2
Gene Alias CHC1L
Gene Description regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEEELPLFSGDSGKPVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPRRVTGCLQNKVVVTIACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCRVAALQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RCBTB2 (NP_001259.1, 1 a.a. ~ 551 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1102

Enviar un mensaje


RCBTB2 purified MaxPab mouse polyclonal antibody (B01P)

RCBTB2 purified MaxPab mouse polyclonal antibody (B01P)