CGB monoclonal antibody (M05), clone 3B4
  • CGB monoclonal antibody (M05), clone 3B4

CGB monoclonal antibody (M05), clone 3B4

Ref: AB-H00001082-M05
CGB monoclonal antibody (M05), clone 3B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CGB.
Información adicional
Size 100 ug
Gene Name CGB
Gene Alias CGB3|hCGB
Gene Description chorionic gonadotropin, beta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CGB (AAH41054.1, 70 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1082
Clone Number 3B4
Iso type IgG1 Kappa

Enviar un mensaje


CGB monoclonal antibody (M05), clone 3B4

CGB monoclonal antibody (M05), clone 3B4