CETN2 purified MaxPab mouse polyclonal antibody (B01P)
  • CETN2 purified MaxPab mouse polyclonal antibody (B01P)

CETN2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001069-B01P
CETN2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CETN2 protein.
Información adicional
Size 50 ug
Gene Name CETN2
Gene Alias CALT|CEN2
Gene Description centrin, EF-hand protein, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CETN2 (NP_004335.1, 1 a.a. ~ 172 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1069

Enviar un mensaje


CETN2 purified MaxPab mouse polyclonal antibody (B01P)

CETN2 purified MaxPab mouse polyclonal antibody (B01P)