CETN2 polyclonal antibody (A01)
  • CETN2 polyclonal antibody (A01)

CETN2 polyclonal antibody (A01)

Ref: AB-H00001069-A01
CETN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CETN2.
Información adicional
Size 50 uL
Gene Name CETN2
Gene Alias CALT|CEN2
Gene Description centrin, EF-hand protein, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CETN2 (AAH05334, 1 a.a. ~ 172 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1069

Enviar un mensaje


CETN2 polyclonal antibody (A01)

CETN2 polyclonal antibody (A01)