CEBPG monoclonal antibody (M03), clone S2
  • CEBPG monoclonal antibody (M03), clone S2

CEBPG monoclonal antibody (M03), clone S2

Ref: AB-H00001054-M03
CEBPG monoclonal antibody (M03), clone S2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CEBPG.
Información adicional
Size 100 ug
Gene Name CEBPG
Gene Alias GPE1BP|IG/EBP-1
Gene Description CCAAT/enhancer binding protein (C/EBP), gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CEBPG (AAH13128, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1054
Clone Number S2
Iso type IgG1 Kappa

Enviar un mensaje


CEBPG monoclonal antibody (M03), clone S2

CEBPG monoclonal antibody (M03), clone S2