CEBPG monoclonal antibody (M01), clone 3A3-1A6
  • CEBPG monoclonal antibody (M01), clone 3A3-1A6

CEBPG monoclonal antibody (M01), clone 3A3-1A6

Ref: AB-H00001054-M01
CEBPG monoclonal antibody (M01), clone 3A3-1A6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CEBPG.
Información adicional
Size 100 ug
Gene Name CEBPG
Gene Alias GPE1BP|IG/EBP-1
Gene Description CCAAT/enhancer binding protein (C/EBP), gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CEBPG (AAH13128, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1054
Clone Number 3A3-1A6
Iso type IgG1 kappa

Enviar un mensaje


CEBPG monoclonal antibody (M01), clone 3A3-1A6

CEBPG monoclonal antibody (M01), clone 3A3-1A6