CEBPE monoclonal antibody (M01), clone 7A4
  • CEBPE monoclonal antibody (M01), clone 7A4

CEBPE monoclonal antibody (M01), clone 7A4

Ref: AB-H00001053-M01
CEBPE monoclonal antibody (M01), clone 7A4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CEBPE.
Información adicional
Size 100 ug
Gene Name CEBPE
Gene Alias C/EBP-epsilon|CRP1
Gene Description CCAAT/enhancer binding protein (C/EBP), epsilon
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CEBPE (AAH35797.2, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1053
Clone Number 7A4
Iso type IgG2a Kappa

Enviar un mensaje


CEBPE monoclonal antibody (M01), clone 7A4

CEBPE monoclonal antibody (M01), clone 7A4