CEBPE purified MaxPab rabbit polyclonal antibody (D01P)
  • CEBPE purified MaxPab rabbit polyclonal antibody (D01P)

CEBPE purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001053-D01P
CEBPE purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CEBPE protein.
Información adicional
Size 100 ug
Gene Name CEBPE
Gene Alias C/EBP-epsilon|CRP1
Gene Description CCAAT/enhancer binding protein (C/EBP), epsilon
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CEBPE (NP_001796.2, 1 a.a. ~ 281 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1053

Enviar un mensaje


CEBPE purified MaxPab rabbit polyclonal antibody (D01P)

CEBPE purified MaxPab rabbit polyclonal antibody (D01P)