CEBPB purified MaxPab mouse polyclonal antibody (B01P)
  • CEBPB purified MaxPab mouse polyclonal antibody (B01P)

CEBPB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001051-B01P
CEBPB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CEBPB protein.
Información adicional
Size 50 ug
Gene Name CEBPB
Gene Alias C/EBP-beta|CRP2|IL6DBP|LAP|MGC32080|NF-IL6|TCF5
Gene Description CCAAT/enhancer binding protein (C/EBP), beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CEBPB (AAH21931.1, 1 a.a. ~ 345 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1051

Enviar un mensaje


CEBPB purified MaxPab mouse polyclonal antibody (B01P)

CEBPB purified MaxPab mouse polyclonal antibody (B01P)